Skip to content

34. vamanavirēcanavyāpaccikitsitam

Adhikarana 1 (1-3) · Śloka 3

athātō vamanavirēcanavyāpaccikitsitaṁ vyākhyāsyāmaḥ ||1|| yathōvāca bhagavān dhanvantariḥ ||2|| vaidyāturanimittaṁ vamanaṁ virēcanaṁ ca pañcadaśadhā vyāpadyatē | tatra vamanasyādhō gatirūrdhvaṁ virēcanasyēti pr̥thak; sāmānyamubhayōḥ- sāvaśēṣauṣadhatvaṁ, jīrṇauṣadhatvaṁ, hīnadōṣāpahr̥tatvaṁ, vātaśūlam, ayōgō, atiyōgō, jīvādānam, ādhmānaṁ, parikartikā, parisrāvaḥ, pravāhikā, hr̥dayōpasaraṇaṁ, vibandha, aṅgapragraha iti ||3||

View original

अथातो वमनविरेचनव्यापच्चिकित्सितं व्याख्यास्यामः ||१|| यथोवाच भगवान् धन्वन्तरिः ||२|| वैद्यातुरनिमित्तं वमनं विरेचनं च पञ्चदशधा व्यापद्यते | तत्र वमनस्याधो गतिरूर्ध्वं विरेचनस्येति पृथक्; सामान्यमुभयोः- सावशेषौषधत्वं, जीर्णौषधत्वं, हीनदोषापहृतत्वं, वातशूलम्, अयोगो, अतियोगो, जीवादानम्, आध्मानं, परिकर्तिका, परिस्रावः, प्रवाहिका, हृदयोपसरणं, विबन्ध, अङ्गप्रग्रह इति ||३||

Meaning of the śloka

The chapter opens by announcing the treatment of complications arising from vamana and virecana. It says that these therapies may fail in fifteen ways because of factors connected with the physician and patient. Vamana may move downward and virecana upward; thirteen further complications are common to both: medicine remaining incompletely expelled, medicine becoming digested, insufficient removal of dosas, vata pain, inadequate action, excessive action, discharge of living tissue or blood, abdominal distension, cutting pain, continued discharge, straining dysentery-like evacuation, involvement of the heart, obstruction, and rigidity of the limbs.

🔊 Audio coming soon

Hide commentary

vaidyāturagrahaṇēnaiva bhēṣajaparicārakayōrgrahaṇam, atastayōrapi vyāpannimittatā syāt| tatrētyādi| tatra vamanasyādhōgatiḥ ‘vyāpat’ iti śēṣaḥ| ūrdhvagatirvirēcanasyētyatrāpi ‘vyāpat’ iti śēṣaḥ| ubhayōstu vamanavirēcanayōḥ sāvaśēṣauṣadhādikaṁ trayōdaśasaṅkhyōpētaṁ vyāpattvēna sāmānyaṁ tulyam| saṅkhyēyanirdēśē'pi pañcadaśadhēti saṅkhyākaraṇaṁ tantrāntarōktasaṅkhyāniṣēdhārtham||1-3||

Meaning of the commentary

The commentary says that naming the physician and patient also implicitly includes the medicine and attendant, so each may contribute to a complication. It supplies the omitted word 'complication' after the downward movement of vamana and the upward movement of virecana. The remaining thirteen complications are shared equally by vamana and virecana. The total of fifteen is stated, despite the list itself, to exclude different counts given in other treatises.

Key terms

vamana
Therapeutic emesis in the classical regimen.
virecana
Therapeutic purgation in the classical regimen.
vyāpat
A complication or failed course of treatment.
jīvādāna
A dangerous complication named in the list, traditionally associated with discharge of vital material or blood.
hṛdayopasaraṇa
A complication described as approaching or involving the heart.

Adhikarana 2 (4) · Śloka 4

tatra bubhukṣāpīḍitasyātitīkṣaṇāgnērmr̥dukōṣṭhasya cāvatiṣṭhamānaṁ durvamasya vā guṇasāmānyabhāvādvamanamadhō gacchati, tatrēpsitānavāptirdōṣōtklēśaśca ; tamāśu snēhayitvā bhūyastīkṣṇatarairvāmayēt ||4||

View original

तत्र बुभुक्षापीडितस्यातितीक्षणाग्नेर्मृदुकोष्ठस्य चावतिष्ठमानं दुर्वमस्य वा गुणसामान्यभावाद्वमनमधो गच्छति, तत्रेप्सितानवाप्तिर्दोषोत्क्लेशश्च ; तमाशु स्नेहयित्वा भूयस्तीक्ष्णतरैर्वामयेत् ||४||

Meaning of the śloka

Vamana may move downward in a person distressed by hunger, one with very sharp agni or a soft kostha, or one who is difficult to make vomit when the medicine remains in the body; the text attributes this to similarity of qualities. The intended result is then not obtained and the dosa becomes stirred up. The passage historically directs renewed, stronger vamana after oleation.

🔊 Audio coming soon

Hide commentary

vamanasyādhōgamanākhyāṁ vyāpadaṁ darśayannāha- tatrētyādi| prathamaṁ kṣutpīḍitasya pītamātramēvādhō yāti, tīkṣṇāgnēragnibalāt pākaṁ yāti, mr̥dukōṣṭhasyāpi kōṣṭhamārdavādadhō yāti, durvamasya cāvatiṣṭhamānaṁ pākaṁ gacchat saratvādiguṇasāmyādadhō yāti| dōṣōtklēśaścēti dōṣasya sāmānyavācitvē'pi kaphō gr̥hyatē, tasya vamanārhatvāt| snēhayitvētyatra snēhēnaiva svēda ākṣiptō bōddhavyaḥ||4||

Meaning of the commentary

The commentary distinguishes the proposed causes. In a hungry person the medicine passes downward immediately; in one with sharp agni it is digested; in one with soft kostha it descends because of bowel softness; and in a person difficult to make vomit, retained medicine becomes digested and moves downward because of qualities such as fluidity. Although dosa is a general term, the commentator understands kapha here because it is the target of vamana. Fomentation is taken as implied together with oleation.

Key terms

adhogati
Downward movement of a medicine intended for vamana.
tīkṣṇāgni
Very sharp digestive activity in the classical classification.
mṛdukoṣṭha
A soft or readily responsive bowel constitution.
doṣotkleśa
Stirring up or aggravation of dosa; interpreted here as kapha.

Adhikarana 3 (5) · Śloka 5

apariśuddhāmāśayasyōtkliṣṭaślēṣmaṇaḥ saśēṣānnasya vā'hr̥dyamatiprabhūtaṁ vā virēcanaṁ pītamūrdhvaṁ gacchati, tatrēpsitānavāptirdōṣōklēśaśca ; tatrāśuddhāmāśayamulbaṇaślēṣmāṇamāśu vāmayitvā bhūyastīkṣṇatarairvirēcayēt, āmānvayē tvāmavat saṁvidhānam, ahr̥dyē'tiprabhūtē ca hr̥dyaṁ pramāṇayuktaṁ ca; ata ūrdhvamuttiṣṭhatyauṣadhē na tr̥tīyaṁ pāyayēt, tatastvēnaṁ madhughr̥taphāṇitayuktairlēhairvirēcayēt ||5||

View original

अपरिशुद्धामाशयस्योत्क्लिष्टश्लेष्मणः सशेषान्नस्य वाऽहृद्यमतिप्रभूतं वा विरेचनं पीतमूर्ध्वं गच्छति, तत्रेप्सितानवाप्तिर्दोषोक्लेशश्च ; तत्राशुद्धामाशयमुल्बणश्लेष्माणमाशु वामयित्वा भूयस्तीक्ष्णतरैर्विरेचयेत्, आमान्वये त्वामवत् संविधानम्, अहृद्येऽतिप्रभूते च हृद्यं प्रमाणयुक्तं च; अत ऊर्ध्वमुत्तिष्ठत्यौषधे न तृतीयं पाययेत्, ततस्त्वेनं मधुघृतफाणितयुक्तैर्लेहैर्विरेचयेत् ||५||

Meaning of the śloka

Virecana may move upward when the stomach has not been cleared, slesma is stirred up, food remains, or the medicine is disagreeable or excessive. The intended result is not obtained and the dosa becomes disturbed. The text then gives different historical responses according to the proposed cause: clearing prominent slesma before repeating virecana, managing ama as such, choosing an agreeable and measured medicine, and, after two upward expulsions, avoiding a third administration and instead using a lickable preparation containing honey, ghee, and phanita.

🔊 Audio coming soon

Hide commentary

virēcanasyōrdhvagativyāpadaṁ darśayannāha- apariśuddhētyādi| dōṣō'tra pittam| āmavat saṁvidhānaṁ laṅghanapācanādi| na tr̥tīyaṁ pāyayēt ‘virēcanamauṣadham’ iti śēṣaḥ| atha kēna virēcayēt? tadāha- tatastvēnamityādi||5||

Meaning of the commentary

The commentary identifies this as the upward-movement complication of virecana and understands dosa here as pitta. For association with ama, it explains the management as measures such as lightening and digestion-promoting treatment. It supplies 'purgative medicine' after the direction not to give a third dose, and says the final lickable preparation is the means proposed for producing virecana.

Key terms

ūrdhvagati
Upward expulsion of medicine intended to act as virecana.
āma
An incompletely processed state in the classical account.
utkliṣṭa śleṣman
Stirred-up or prominent slesma described as obstructing the intended action.
phāṇita
A concentrated sweet preparation named as an ingredient in the historical formulation.

Adhikarana 4 (6) · Śloka 6

dōṣavigrathitamalpamauṣadhamavasthitamūrdhvabhāgikramadhōbhāgikaṁ vā na sraṁsayati dōṣān, tatra tr̥ṣṇā pārśvaśūlaṁ chardirmūrcchā parvabhēdō hr̥llāsō'ratirudgārāviśuddhiśca bhavati; tamuṣṇābhiradbhirāśu vāmayēdūrdhvabhāgikē, adhōbhāgikē'pi ca sāvaśēṣauṣadhamatipradhāvitadōṣamatibalamasamyagviriktalakṣaṇamapyēvaṁ vāmayēt ||6||

View original

दोषविग्रथितमल्पमौषधमवस्थितमूर्ध्वभागिक्रमधोभागिकं वा न स्रंसयति दोषान्, तत्र तृष्णा पार्श्वशूलं छर्दिर्मूर्च्छा पर्वभेदो हृल्लासोऽरतिरुद्गाराविशुद्धिश्च भवति; तमुष्णाभिरद्भिराशु वामयेदूर्ध्वभागिके, अधोभागिकेऽपि च सावशेषौषधमतिप्रधावितदोषमतिबलमसम्यग्विरिक्तलक्षणमप्येवं वामयेत् ||६||

Meaning of the śloka

A small amount of medicine entangled with the dosas may remain and fail to dislodge them, whether intended for the upper or lower route. The resulting signs are thirst, flank pain, vomiting, fainting, pain at the joints, nausea, restlessness, and unclean belching. The passage historically directs emesis when an emetic remains, and also in a very strong person when residual purgative medicine is associated with rapidly moving dosas and signs of incomplete purgation.

🔊 Audio coming soon

Hide commentary

sāvaśēṣauṣadhavyāpadaṁ sāmānyēnōbhayōrdarśayannāha- dōṣētyādi| dōṣavigrathitaṁ dōṣamiśritam| na sraṁsayati na cyāvayati| parvabhēdaḥ granthisphuṭanam| hr̥llāsaḥ thūtkaraṇaṁ, ‘thukathukī’ iti lōkē| aratirna kutracidavasthitiścittasya| tamavasthitālpauṣadhaṁ tr̥ṣṇādyanvitamūrdhvabhāgikē vamanadravyaviṣayē vāmayēt| adhōbhāgikē'pyavasthāviśēṣē vamanamuddiśannāha- adhōbhāgikē'pi cētyādi| adhōbhāgikē virēcanadravyaviṣayē yaḥ sāvaśēṣauṣadhō'tipradhāvitadōṣastamasamyagviriktamapyatipradhāvitadōṣatvahētunā vāmayēt paramatibalaṁ puruṣam||6||

Meaning of the commentary

The commentary presents residual medicine as a complication shared by both therapies. It glosses doṣavigrathita as mixed with dosa and 'does not release' as does not dislodge it. It explains parvabheda as a splitting sensation at the joints, hṛllāsa as retching, and arati as mental inability to remain settled. For retained emetic medicine accompanied by the listed symptoms, it gives the stated response. In the purgative context, it restricts that response to a person of exceptional strength whose dosas have moved excessively, even if signs of incomplete purgation are present.

Key terms

sāvaśeṣauṣadha
Medicine remaining incompletely expelled or active after the intended therapy.
doṣavigrathita
Intermingled or entangled with dosa, according to the commentary.
parvabheda
A splitting or breaking-like pain at the joints.
hṛllāsa
Nausea or retching in the commentator's explanation.

Adhikarana 5 (7) · Śloka 7

krūrakōṣṭhasyātitīkṣṇāgnēralpamauṣadhamalpaguṇaṁ vā bhaktavat pākamupaiti, tatra samudīrṇā dōṣā yathākālamanirhrīyamāṇā vyādhivibhramaṁ balavibhraṁśaṁ cāpādayanti, tamanalpamamandamauṣadhaṁ ca pāyayēt ||7||

View original

क्रूरकोष्ठस्यातितीक्ष्णाग्नेरल्पमौषधमल्पगुणं वा भक्तवत् पाकमुपैति, तत्र समुदीर्णा दोषा यथाकालमनिर्ह्रीयमाणा व्याधिविभ्रमं बलविभ्रंशं चापादयन्ति, तमनल्पममन्दमौषधं च पाययेत् ||७||

Meaning of the śloka

In a person with a hard kostha or very sharp agni, medicine that is too little or weak may be digested like food. The aroused dosas, not removed at the proper time, are said to cause disturbance of disease and loss of strength. The text historically directs giving medicine that is neither small in amount nor mild.

🔊 Audio coming soon

Hide commentary

jīrṇauṣadhavyāpadaṁ darśayannāha- krūrētyādi| samudīrṇāḥ prakupitāḥ, vyādhivibhramaṁ kōṣṭhādikṣōbhalakṣaṇam| balavibhraṁśaṁ sandhiviślēṣādilakṣaṇaṁ dōṣādivijñānīyōktam| tamanalpamityādi prabhūtaṁ tīkṣṇaṁ ca pātuṁ prayacchēt||7||

Meaning of the commentary

The commentary identifies this as the complication in which the medicine has been digested. It glosses samudīrṇa as aggravated, vyādhivibhrama as disturbance of the kostha and related systems, and balavibhraṃśa by reference to signs such as loosening of joints described elsewhere. It interprets the final phrase as directing a plentiful and sharp medicine.

Key terms

jīrṇauṣadha
Medicine digested without producing its intended eliminative action.
krūrakoṣṭha
A hard or difficult-to-purge bowel constitution in the classical classification.
vyādhivibhrama
A disturbance or worsening of disease, glossed as agitation of the kostha and related systems.
balavibhraṃśa
Loss or disruption of strength.

Adhikarana 6 (8) · Śloka 8

asnigdhasvinnēnālpaguṇaṁ vā bhēṣajamupayuktamalpān dōṣān hanti; tatra vamanē dōṣaśēṣō gauravamutklēśaṁ hr̥dayāviśuddhiṁ vyādhivr̥ddhiṁ ca karōti, tatra taṁ yathāyōgaṁ pāyayitvā vāmayēddr̥ḍhataraṁ; virēcanē tu gudaparikartanamādhmānaṁ śirōgauravamaniḥsaraṇaṁ vā vāyōrvyādhivr̥ddhiṁ ca karōti; tamupapādya bhūyaḥ snēhasvēdābhyāṁ virēcayēddr̥ḍhataraṁ, dr̥ḍhaṁ bahupracalitadōṣaṁ vā tr̥tīyē divasē'lpaguṇaṁ cēti ||8||

View original

अस्निग्धस्विन्नेनाल्पगुणं वा भेषजमुपयुक्तमल्पान् दोषान् हन्ति; तत्र वमने दोषशेषो गौरवमुत्क्लेशं हृदयाविशुद्धिं व्याधिवृद्धिं च करोति, तत्र तं यथायोगं पाययित्वा वामयेद्दृढतरं; विरेचने तु गुदपरिकर्तनमाध्मानं शिरोगौरवमनिःसरणं वा वायोर्व्याधिवृद्धिं च करोति; तमुपपाद्य भूयः स्नेहस्वेदाभ्यां विरेचयेद्दृढतरं, दृढं बहुप्रचलितदोषं वा तृतीये दिवसेऽल्पगुणं चेति ||८||

Meaning of the śloka

When a person has not been oleated and fomented, or when a weak medicine is used, only a small amount of dosa is removed. After vamana, the residue may cause heaviness, agitation, a sense that the heart region is uncleared, and worsening disease. After virecana, it may cause cutting pain at the anus, distension, heaviness of the head, failure of vata to pass, and worsening disease. The passage then gives historical directions for stronger repeat elimination after preparation and, in specified robust cases, on the third day.

🔊 Audio coming soon

Hide commentary

alpadōṣahr̥tivyāpadaṁ darśayannāha- asnigdhasvinnēnētyādi| alpō'tisūkṣmō guṇō yasya tattathā tam| taṁ dōṣaśēṣam| yathāyōgaṁ yōgānatikramēṇa snēhādipūrvamityarthaḥ| pāyayitvā ‘āturaṁ vamanadravyam’ iti śēṣaḥ| dr̥ḍhataramiti dr̥ḍhataraṁ yathā bhavati tathā| virēcanē tviti atrāpi dōṣaśēṣa iti sambadhyatē| gudaparikartanaṁ gudasya sarvataḥ kartanamiva vēdanāviśēṣaḥ| dr̥ḍhadēhaṁ bahudōṣaṁ pracalitadōṣaṁ ca pūrvaṁ snigdhasvinnaṁ tr̥tīyē'hni; anyē tu vamanadivasādvirēcanadivasādvā tr̥tīyadivasē vāmayēdvirēcayēdvēti||8||

Meaning of the commentary

The commentary identifies insufficient removal of dosa as the complication. It interprets alpaguṇa as having very slight potency and takes 'that' to mean the remaining dosa. Yathāyoga means without exceeding the proper course, with oleation and related preparation first; omitted words are supplied to mean giving the patient an emetic, with enough force to act strongly. The phrase about remaining dosa also carries into the virecana section. Gudaparikartana is explained as cutting-like pain all around the anus. One interpretation places repeat treatment for a strong-bodied person with abundant, mobilized dosas on the third day after prior oleation and fomentation; others count the third day specifically from the day of vamana or virecana. These timing interpretations remain distinct.

Key terms

hīnadoṣāpahṛta
A complication in which too little dosa has been removed.
gudaparikartana
Cutting-like pain around the anus.
ādhmāna
Abdominal distension.
aniḥsaraṇa vāyu
Failure of vata or flatus to pass in the classical description.

Adhikarana 7 (9) · Śloka 9

asnigdhasvinnēna rūkṣauṣadhamupayuktamabrahmacāriṇā vā vāyuṁ kōpayati, tatra vāyuḥ prakupitaḥ pārśvapr̥ṣṭhaśrōṇimanyāmarmaśūlaṁ mūrcchāṁ bhramaṁ madaṁ sañjñānāśaṁ ca karōti, taṁ vātaśūlamityācakṣatē; tamabhyajya dhānyasvēdēna svēdayitvā yaṣṭīmadhukavipakvēna tailēnānuvāsayēt ||9||

View original

अस्निग्धस्विन्नेन रूक्षौषधमुपयुक्तमब्रह्मचारिणा वा वायुं कोपयति, तत्र वायुः प्रकुपितः पार्श्वपृष्ठश्रोणिमन्यामर्मशूलं मूर्च्छां भ्रमं मदं सञ्ज्ञानाशं च करोति, तं वातशूलमित्याचक्षते; तमभ्यज्य धान्यस्वेदेन स्वेदयित्वा यष्टीमधुकविपक्वेन तैलेनानुवासयेत् ||९||

Meaning of the śloka

A dry medicine taken by a person who has not been oleated or fomented, or by one who has not observed brahmacarya, may aggravate vayu. The aggravated vayu is said to produce pain in the flanks, back, pelvis, neck, and vital regions, together with fainting, vertigo, intoxication-like impairment, and loss of consciousness; this is called vata pain. The passage then gives a historical sequence of oil application, sweating with grains, and an oil enema prepared with yastimadhu.

🔊 Audio coming soon

Hide commentary

vātaśūlavyāpadaṁ darśayannāha- asnigdhētyādi| śrōṇiḥ kaṭiḥ, marmātra hr̥dayam| bhramaḥ cakrārūḍhasyēva bhramaṇam| madaḥ pūgaphalādanēnēva mattatā| dhānyasvēdēna māṣādiśamīdhānyasvēdēna| mūrcchābhramayōranuvāsanapratiṣēdhavyavasthāpēkṣayā śītalēna yaṣṭīmadhukatailēnānuvāsanaṁ vēditavyamiti ||9||

Meaning of the commentary

The commentary identifies this as the vātashūla complication. It glosses śroṇi as the waist or pelvic region and understands marma here as the heart. Bhrama is compared to the sensation of being spun on a wheel, while mada is compared to intoxication after eating areca nut. Dhānyasveda is explained as fomentation using grains such as māṣa and śamī. Because enemas are restricted in fainting and vertigo, the commentator says the yaṣṭīmadhu oil enema should be understood as cool; this qualification and its reasoning should be preserved as the commentator's view.

Key terms

vātashūla
Pain attributed to aggravated vayu in this complication.
mūrcchā
Fainting or loss of consciousness.
bhrama
Vertigo or a spinning sensation.
saṃjñānāśa
Loss of awareness or consciousness.
anuvāsana
An oil-based enema in the historical regimen.

Adhikarana 8 (10) · Śloka 10

snēhasvēdābhyāmavibhāvitaśarīrēṇālpamauṣadhamalpaguṇaṁ vā pītamūrdhvamadhō vā nābhyēti dōṣāṁścōtklēśya taiḥ saha balakṣayamāpādayati, tatrādhmānaṁ hr̥dayagrahastr̥ṣṇā mūrcchā dāhaśca bhavati, tamayōgamityācakṣatē; tamāśu vāmayēnmadanaphalalavaṇāmbubhirvirēcayēttīkṣṇataraiḥ kaṣāyaiśca | durvāntasya tu samutkliṣṭā dōṣā vyāpya śarīraṁ kaṇḍūśvayathukuṣṭhapiḍakājvarāṅgamardanistōdanāni kurvanti, tatastānaśēṣānmahauṣadhēnāpaharēt | asnigdhasvinnasya durviriktasyādhōnābhēḥ stabdhapūrṇōdaratā śūlaṁ vātapurīṣasaṅgaḥ kaṇḍūmaṇḍalaprādurbhāvō vā bhavati, tamāsthāpya punaḥ saṁsnēhya virēcayēttīkṣṇēna | nātipravartamānē tiṣṭhati vā duṣṭasaṁśōdhanē tatsantējanārthamuṣṇōdakaṁ pāyayēt, pāṇitāpaiśca pārśvōdaramupasvēdayēt, tataḥ pravartantē dōṣāḥ | anupravr̥ttē cālpadōṣē jīrṇauṣadhaṁ bahudōṣamahaḥśēṣaṁ balaṁ cāvēkṣya bhūyō mātrāṁ vidadhyāt | apravr̥ttadōṣaṁ daśarātrādūrdhvamupasaṁskr̥tadēhaṁ snēhasvēdābhyāṁ bhūyaḥ śōdhayēt | durvirēcyamāsthāpya punaḥ saṁsnēhya virēcayēt | hrībhayalōbhairvēgāghātaśīlāḥ prāyaśaḥ striyō rājasamīpasthā vaṇijaḥ śrōtriyāśca bhavanti, tasmādētē durvirēcyāḥ, bahuvātatvāt; ata ēva tānatisnigdhān svēdōpapannāñ śōdhayēt ||10||

View original

स्नेहस्वेदाभ्यामविभावितशरीरेणाल्पमौषधमल्पगुणं वा पीतमूर्ध्वमधो वा नाभ्येति दोषांश्चोत्क्लेश्य तैः सह बलक्षयमापादयति, तत्राध्मानं हृदयग्रहस्तृष्णा मूर्च्छा दाहश्च भवति, तमयोगमित्याचक्षते; तमाशु वामयेन्मदनफललवणाम्बुभिर्विरेचयेत्तीक्ष्णतरैः कषायैश्च | दुर्वान्तस्य तु समुत्क्लिष्टा दोषा व्याप्य शरीरं कण्डूश्वयथुकुष्ठपिडकाज्वराङ्गमर्दनिस्तोदनानि कुर्वन्ति, ततस्तानशेषान्महौषधेनापहरेत् | अस्निग्धस्विन्नस्य दुर्विरिक्तस्याधोनाभेः स्तब्धपूर्णोदरता शूलं वातपुरीषसङ्गः कण्डूमण्डलप्रादुर्भावो वा भवति, तमास्थाप्य पुनः संस्नेह्य विरेचयेत्तीक्ष्णेन | नातिप्रवर्तमाने तिष्ठति वा दुष्टसंशोधने तत्सन्तेजनार्थमुष्णोदकं पाययेत्, पाणितापैश्च पार्श्वोदरमुपस्वेदयेत्, ततः प्रवर्तन्ते दोषाः | अनुप्रवृत्ते चाल्पदोषे जीर्णौषधं बहुदोषमहःशेषं बलं चावेक्ष्य भूयो मात्रां विदध्यात् | अप्रवृत्तदोषं दशरात्रादूर्ध्वमुपसंस्कृतदेहं स्नेहस्वेदाभ्यां भूयः शोधयेत् | दुर्विरेच्यमास्थाप्य पुनः संस्नेह्य विरेचयेत् | ह्रीभयलोभैर्वेगाघातशीलाः प्रायशः स्त्रियो राजसमीपस्था वणिजः श्रोत्रियाश्च भवन्ति, तस्मादेते दुर्विरेच्याः, बहुवातत्वात्; अत एव तानतिस्निग्धान् स्वेदोपपन्नाञ् शोधयेत् ||१०||

Meaning of the śloka

When a person has not been properly prepared with sneha and sveda, a medicine that is too small in quantity or too weak may move neither upward nor downward. It agitates the doṣas without removing them and causes loss of strength, abdominal distension, constriction around the heart, thirst, fainting, and burning; this is called ayoga, inadequate action. The passage then describes distinct signs after inadequate vamana or virecana and sets out historical corrective measures. It also discusses what was advised when elimination began only slightly or not at all, and identifies suppression of urges through shame, fear, or greed as a reason some people were considered difficult to purge.

🔊 Audio coming soon

Hide commentary

ayōgavyāpadaṁ darśayannāha- snēhētyādi| bahuvyāpattvādētān susnigdhasvinnān svairaṁ rēcayēt| snēhasvēdābhyāmavibhāvitaśarīrēṇa sarvathaivāsnigdhasvinnēnētyarthaḥ| nābhyēti na gacchati| dōṣāṁścōtkliśya tairdōṣaiḥ saha balakṣayamāpādayati, tathā''dhmānādikaṁ karōti| tamayōgamityācakṣatē iti anēna pāribhāṣikatvamayōgasya darśayati| iti hētōralpadōṣahr̥tatvamayōgō na bhavati| madanādibhirvāmayēdvamanāyōgē; tīkṣṇatarakaṣāyairvirēcayēdvirēcanāyōgē| tatra balakṣayādhmānādikaṁ sarvathā'pravr̥ttayōrvamanavirēcanayōḥ sāmānyakāryaliṅgam| pr̥thak cikitsitamabhidhāya tēna cikitsitēnōtpannairhr̥llāsaprasēkālpaviṭpravr̥ttinābhyadhōgauravādibhiranumitayōrvamanavirēcanāyōgayōḥ pr̥thak liṅgaṁ cikitsitaṁ cāha- durvāntasyētyādi| kaṇḍvādidurvāntaliṅginaṁ vātapūrṇōdarādidurviriktaliṅginaṁ cāsthāpya nirūhya, saṁsnēhya snēhabastinā, tatastīkṣṇēna nirūhaṇēna virēcanēna ca virēcayēt| atrāyōgaprasaṅgēnālpadōṣahr̥tatvēna ca pravartanōpāyaṁ darśayannāha- nētyādi| tathā'lpapravr̥ttau dvitīyaṁ karaṇīyaṁ darśayannāha- anupravr̥ttētyādi| jīrṇauṣadhaṁ prabhūtadōṣaṁ puruṣaṁ vīkṣya tathā dēhasya balaṁ ca dvitīyauṣadhaṁ vidadhyāt| alpadōṣapravr̥ttau tadaharēva bhēṣajamabhidhāya sarvathā dōṣāpravr̥ttau vidhimāha- apravr̥ttadōṣamityādi| pathyāhārasnēhādinōpaskārēṇa daśarātramativāhya tata ūrdhvaṁ vamanavirēcanābhyāṁ śōdhayēt| sukhavirēcyasya kriyāmabhidhāya durvirēcyasyāha- durvirēcyamityādi| svabhāvāddurvirēcyānnirdiśya hētuviśēṣaṁ durvirēcanē nirdiśannāha- hrībhayētyādi| tatra hriyā lajjayā vēgāghātaśīlāḥ striyō, bhayēna rājasamīpasthā, lōbhēna vaṇijaḥ śrōtriyāśca, tasmāttānatisnigdhāñchōdhayēt||10||

Meaning of the commentary

The commentary defines ayoga technically as complete failure of vamana or virecana to proceed, rather than merely removal of too little doṣa. Loss of strength and distension are common signs of either failure; nausea, salivation, scant stool, and heaviness below the navel help distinguish the two forms after attempted correction. It explains the text's successive historical responses to difficult vomiting, difficult purgation, slight action, and complete non-action. A second medicine is said to depend on whether the first has been digested, the abundance of doṣa, the remaining part of the day, and the person's strength. When no doṣa has moved, the commentary reads the interval as ten nights with dietary and oleation preparation before another attempt. It explains the social groups named in the source through habitual suppression of urges: women through shame, persons near a king through fear, and merchants and learned ritual specialists through greed. These statements reflect the commentator's historical assumptions and should not be generalized.

Key terms

ayoga
Complete inadequate action or non-action of the intended eliminative procedure in this passage.
sneha-sveda
Oleation and fomentation described as preparation in the classical regimen.
durvānta
A state in which the intended vomiting has occurred inadequately.
durvirecya
A person described as difficult to purge within the text's classification.

Adhikarana 9 (11) · Śloka 11

snigdhasvinnasyātimātramatimr̥dukōṣṭhasya vā'titīkṣṇamadhikaṁ vā dattamauṣadhamatiyōgaṁ kuryāt | tatra vamanātiyōgē pittātipravr̥ttirbalavisraṁsō vātakōpaśca balavān bhavati, taṁ ghr̥tēnābhyajyāvagāhya śītāsvapsu śarkarāmadhumiśrairlēhairupacarēdyathāsvaṁ; virēcanātiyōgē kaphasyātipravr̥ttiruttarakālaṁ ca saraktasya, tatrāpi balavisraṁsō vātakōpaśca balavān bhavati, tamatiśītāmbubhiḥ pariṣicyāvagāhya vā śītaistaṇḍulāmbubhirmadhumiśraiśchardayēt, picchābastiṁ cāsmai dadyāt, kṣīrasarpiṣā cainamanuvāsayēt, priyaṅgvādiṁ cāsmai taṇḍulāmbunā pātuṁ prayacchēt, kṣīrarasayōścānyatarēṇa bhōjayēt ||11||

View original

स्निग्धस्विन्नस्यातिमात्रमतिमृदुकोष्ठस्य वाऽतितीक्ष्णमधिकं वा दत्तमौषधमतियोगं कुर्यात् | तत्र वमनातियोगे पित्तातिप्रवृत्तिर्बलविस्रंसो वातकोपश्च बलवान् भवति, तं घृतेनाभ्यज्यावगाह्य शीतास्वप्सु शर्करामधुमिश्रैर्लेहैरुपचरेद्यथास्वं; विरेचनातियोगे कफस्यातिप्रवृत्तिरुत्तरकालं च सरक्तस्य, तत्रापि बलविस्रंसो वातकोपश्च बलवान् भवति, तमतिशीताम्बुभिः परिषिच्यावगाह्य वा शीतैस्तण्डुलाम्बुभिर्मधुमिश्रैश्छर्दयेत्, पिच्छाबस्तिं चास्मै दद्यात्, क्षीरसर्पिषा चैनमनुवासयेत्, प्रियङ्ग्वादिं चास्मै तण्डुलाम्बुना पातुं प्रयच्छेत्, क्षीररसयोश्चान्यतरेण भोजयेत् ||११||

Meaning of the śloka

An excessive dose, an excessively sharp medicine, or too much medicine given to a person already oleated and fomented, especially one with very soft koṣṭha, may cause atiyoga, excessive action. Excessive vamana is said to produce excessive flow of pitta, marked loss of strength, and strong aggravation of vāta. Excessive virecana first produces excessive kapha-like discharge and later blood-stained discharge, again with severe weakness and vāta aggravation. The passage lists historical measures intended to counter these states and restore strength.

🔊 Audio coming soon

Hide commentary

idānīmatiyōgavyāpadaṁ darśayannāha- snigdhētyādi| balavisraṁsaḥ śaktivisraṁsaḥ | yathāsvamiti yasya yadātmīyaṁ tadyathāsvaṁ; tēna lājaśaktūpakalpitaiḥ kvaciccharkarāmiśraiḥ kvacinmadhumiśrairityarthaḥ| picchābastirvakṣyamāṇaḥ| kṣīrasarpiṣā kṣīrōtthēna ghr̥tēna| taṇḍulāmbumadhucchardanamadhaḥpravr̥ttasya ślēṣmaṇaḥ pratibandhārthaṁ, picchābastiprayōgō raktapittātipravr̥ttiparihārāya, kṣīrasarpiṣā'nuvāsanaṁ vātapratibandhāya, taṇḍulāmbunā saha priyaṅgvādiprayōgaḥ karṣapramāṇaḥ saṅgrahaṇāya, kṣīrarasaiśca bhōjanaṁ balapratilambhāya| gayī tu picchābastiṁ cāsmai dadyādityanantaraṁ picchābastyaṅgatvēna kṣīrarasābhyāṁ cainamiti pāṭhaṁ paṭhati||11||

Meaning of the commentary

The commentary glosses balavisraṃsa as collapse or loss of bodily power. It explains yathāsvam as selecting the appropriate preparation, sometimes made from parched grain or flour with sugar and sometimes with honey. Kṣīrasarpis is clarified as ghee derived from milk. The listed interventions are assigned separate purposes within the traditional reasoning: a rice-water and honey emetic was intended to check downward-moving śleṣman; picchā-basti to restrain excessive blood and pitta discharge; milk-ghee anuvasana to restrain vāta; priyaṅgvādi with rice-water, in a stated traditional measure, to promote retention; and milk or meat broth to recover strength. Gayi preserves a different reading in which milk and meat broth belong among the constituents of the picchā-basti; that textual variant must remain distinct.

Key terms

atiyoga
Excessive action of vamana or virecana and its complications.
balavisraṃsa
A severe collapse or loss of strength, as glossed by the commentary.
picchā-basti
A retaining or mucilaginous enema named in the historical response.
kṣīrasarpis
Ghee derived from milk, according to the commentary.

Adhikarana 10 (12-14) · Śloka 14

tasminnēva vamanātiyōgē pravr̥ddhē śōṇitaṁ ṣṭhīvati rchdayati vā, tatra jihvāniḥsaraṇamapasaraṇamakṣṇōrvyāvr̥ttirhanusaṁhananaṁ tr̥ṣṇā hikkā jvarō vaisañjñyamityupadravā bhavanti; tamajāsr̥kcandanōśīrāñjanalājacūrṇaiḥ saśarkarōdakairmanthaṁ pāyayēt, phalarasairvā saghr̥takṣaudraśarkaraiḥ śuṅgābhirvā vaṭādīnāṁ pēyāṁ siddhāṁ sakṣaudrāṁ varcōgrāhibhirvā, payasā jāṅgalarasēna vā bhōjayēt, atisrutaśōṇitavidhānēnōpacarēt; jihvāmatisarpitāṁ kaṭukalavaṇacūrṇapraghr̥ṣṭāṁ tiladrākṣāpraliptāṁ vā'ntaḥ pīḍayēt, antaḥpraviṣṭāyāmamlamanyē tasya purastāt khādayēyuḥ; vyāvr̥ttē cākṣiṇī ghr̥tābhyaktē pīḍayēt, hanusaṁhananē vātaślēṣmaharaṁ nasyaṁ svēdāṁśca vidadhyāt, tr̥ṣṇādiṣu ca yathāsvaṁ pratikurvīta, visañjñē vēṇuvīṇāgītasvanaṁ śrāvayēt ||12|| virēcanātiyōgē ca sacandrakaṁ salilamadhaḥ sravati tatō māṁsadhāvanaprakāśamuttarakālaṁ jīvaśōṇitaṁ ca, tatō gudaniḥsaraṇaṁ vēpathurvamanātiyōgōpadravāścāsya bhavanti; tamapi niḥsrutaśōṇitavidhānēnōpacarēt, niḥsarpitagudasya gudamabhyajya parisvēdyāntaḥ pīḍayēt kṣudrarōgacikitsitaṁ vā vīkṣēta, vēpathau vātavyādhividhānaṁ kurvīta, jihvāniḥsaraṇādiṣūktaḥ pratīkāraḥ, atipravr̥ttē vā jīvaśōṇitē kāśmarīphalabadarīdūrvōśīraiḥ śr̥tēna payasā ghr̥tamaṇḍāñjanayuktēna suśītēnāsthāpayēt, nyagrōdhādikaṣāyēkṣurasaghr̥taśōṇitasaṁsr̥ṣṭaiścainaṁ bastibhirupācarēt, śōṇitaṣṭhīvanē raktapittaraktātīsārakriyāścāsya vidadhyāt, nyagrōdhādiṁ cāsya vidadhyāt pānabhōjanēṣu ||13|| jīvaśōṇitaraktapittayōśca jijñāsārthaṁ tasmin picuṁ plōtaṁ vā kṣipēt, yadyuṣṇōdakaprakṣālitamapi vastraṁ rañjayati tajjīvaśōṇitamavagantavyaṁ; sabhaktaṁ ca śunē dadyācchaktusammiśraṁ vā, sa yadyupabhuñjīta tajjīvaśōṇitamavagantavyam; anyathā raktapittamiti ||14||

View original

तस्मिन्नेव वमनातियोगे प्रवृद्धे शोणितं ष्ठीवति र्छ्दयति वा, तत्र जिह्वानिःसरणमपसरणमक्ष्णोर्व्यावृत्तिर्हनुसंहननं तृष्णा हिक्का ज्वरो वैसञ्ज्ञ्यमित्युपद्रवा भवन्ति; तमजासृक्चन्दनोशीराञ्जनलाजचूर्णैः सशर्करोदकैर्मन्थं पाययेत्, फलरसैर्वा सघृतक्षौद्रशर्करैः शुङ्गाभिर्वा वटादीनां पेयां सिद्धां सक्षौद्रां वर्चोग्राहिभिर्वा, पयसा जाङ्गलरसेन वा भोजयेत्, अतिस्रुतशोणितविधानेनोपचरेत्; जिह्वामतिसर्पितां कटुकलवणचूर्णप्रघृष्टां तिलद्राक्षाप्रलिप्तां वाऽन्तः पीडयेत्, अन्तःप्रविष्टायामम्लमन्ये तस्य पुरस्तात् खादयेयुः; व्यावृत्ते चाक्षिणी घृताभ्यक्ते पीडयेत्, हनुसंहनने वातश्लेष्महरं नस्यं स्वेदांश्च विदध्यात्, तृष्णादिषु च यथास्वं प्रतिकुर्वीत, विसञ्ज्ञे वेणुवीणागीतस्वनं श्रावयेत् ||१२|| विरेचनातियोगे च सचन्द्रकं सलिलमधः स्रवति ततो मांसधावनप्रकाशमुत्तरकालं जीवशोणितं च, ततो गुदनिःसरणं वेपथुर्वमनातियोगोपद्रवाश्चास्य भवन्ति; तमपि निःस्रुतशोणितविधानेनोपचरेत्, निःसर्पितगुदस्य गुदमभ्यज्य परिस्वेद्यान्तः पीडयेत् क्षुद्ररोगचिकित्सितं वा वीक्षेत, वेपथौ वातव्याधिविधानं कुर्वीत, जिह्वानिःसरणादिषूक्तः प्रतीकारः, अतिप्रवृत्ते वा जीवशोणिते काश्मरीफलबदरीदूर्वोशीरैः शृतेन पयसा घृतमण्डाञ्जनयुक्तेन सुशीतेनास्थापयेत्, न्यग्रोधादिकषायेक्षुरसघृतशोणितसंसृष्टैश्चैनं बस्तिभिरुपाचरेत्, शोणितष्ठीवने रक्तपित्तरक्तातीसारक्रियाश्चास्य विदध्यात्, न्यग्रोधादिं चास्य विदध्यात् पानभोजनेषु ||१३|| जीवशोणितरक्तपित्तयोश्च जिज्ञासार्थं तस्मिन् पिचुं प्लोतं वा क्षिपेत्, यद्युष्णोदकप्रक्षालितमपि वस्त्रं रञ्जयति तज्जीवशोणितमवगन्तव्यं; सभक्तं च शुने दद्याच्छक्तुसम्मिश्रं वा, स यद्युपभुञ्जीत तज्जीवशोणितमवगन्तव्यम्; अन्यथा रक्तपित्तमिति ||१४||

Meaning of the śloka

In the most advanced excessive vamana, the person may spit or vomit blood and develop protrusion or retraction of the tongue, abnormal turning of the eyes, locking of the jaw, thirst, hiccup, fever, and loss of consciousness. In excessive virecana, the discharge is described as first watery and patterned, then like water used to wash meat, and later as jīvaśoṇita; prolapse of the rectum, tremor, and complications like those of excessive vamana may follow. The passage records historical responses to bleeding, tongue displacement, eye and jaw abnormalities, prolapse, tremor, and loss of consciousness. It also gives traditional tests intended to distinguish jīvaśoṇita from raktapitta.

🔊 Audio coming soon

Hide commentary

idānīṁ tayōrvamanavirēkātiyōgayōruttamāvasthājīvādānavyāpadaṁ kaṣṭacikitsitārthamāha- tasminnēvētyādi| jihvāyā niḥsaraṇamapasarpaṇaṁ jihvāniḥsarpaṇam, athavā jihvāyā bahirnirgamanaṁ bahirgatirantarapravēśa ityarthaḥ| akṣṇōrvyāvr̥ttiḥ cakṣuṣōrudvr̥ttiḥ| hanusaṁhananaṁ hanusaṁhatiḥ saraṇābhāva ityarthaḥ| tamityādi taṁ vamanātiyōgapravr̥ttaśōṇitaṁ chāgarudhirādibhiḥ plutaṁ manthaṁ pāyayēt| phalarasairvēti dāḍimīphalarasaiḥ| jāṅgalarasēnēti ‘vātaprakr̥tim’ iti śēṣaḥ| antaḥpraviṣṭāyāṁ jihvāyāmamlaphalamanyē tasya purastāt khādayēyuriti ētaddarśanāt mukhaprasēkēna mr̥dubhūtā jihvā yathāsthānamāgacchati| virēcanātiyōgē cētyādi| sacandrakaṁ mayūrapicchacandrakākāram| jīvaśōṇitaṁ śarīrēndriyasattvātmasaṁyōgāśrayaṁ viśuddhaṁ śōṇitamityarthaḥ| vamanātipravr̥ttau tāvacchōṇitaniṣṭhīvanapracchardanē uktē, atra tu māṁsaprakṣālanōdakajīvaśōṇitanirgamābhyāṁ pravr̥ttiruktēti śōṇitapravr̥ttirvamanavirēcanātiyōgē sāmānyaṁ; bhēdastu jihvānissaraṇasthānē'tra gudanissaraṇaṁ, tathā'kṣṇōrvyāvr̥ttirmanāgapi nāsti kintvantaḥpravēśa ēva bhavati, nāsti cāpratyāsattyā hanusaṁhananaṁ hikkōdgārau cēti gayadāsācāryaḥ; jējjaṭācāryastu jihvāniḥsarpaṇaṁ parityajya anyē pravr̥ddhavamanātiyōgōktā upadravā bhavantīti vyākhyāti| vēpathuḥ kampaḥ| vamanātiyōgōpadravā ityādi| sarvāṅgapravr̥ttarasadhātukṣayēṇa vātakr̥tā vamanātiyōgōpadravā pittātipravr̥ttibalavibhraṁśavātakōpatr̥ṣṇāmōhādayaḥ| jihvāpasaraṇādiṣviti jihvāpasarpaṇamatrōpalakṣaṇaṁ, tēna jihvāpasarpaṇādivirēcanātiyōgōtpannēṣu vamanātiyōgōktaḥ pratīkāra iti jējjaṭaḥ| gayī tu jihvānissarpaṇādayō vamanātiyōgē ēva bhavantīti pratipādayitukāmastēṣu cikitsitamabhihitamēvēti pratipādayati- jihvānissarpaṇādiṣvityādinā| uktaḥ pratīkāra iti vamanātiyōgē ityarthaḥ| phalaṁ madanaphalaṁ, ghr̥tamaṇḍaḥ ghr̥tasya styānasyōparyacchō bhāgaḥ| añjanaṁ srōtō'ñjanam| bastikalpanā cātra sāmānyanirūhakalpēna| virēcanātiyōgē jīvaśōṇitātipravr̥ttau cikitsitamupadiśya vamanātiyōgē'pi śōṇitaniṣṭhīvanādau raktātisāraraktapittakriyāmāha- śōṇitētyādi| pānabhōjanasaṁskārē cāsya nyagrōdhādiṁ ṣaḍaṅgōdakakalpēna| tasminniti vāntē'dhaḥpravr̥ttē dhātudravē, picuṁ karpāsatūlakaṁ , plōtaṁ vastraṁ śuklaṁ kṣipēt, tadyadi śuklamuṣṇōdakaprakṣālitaṁ rāgarahitaṁ bhavēttadā jīvaśōṇitaṁ, vivarṇē ca raktapittamiti| vamanavirēcanajīvādānayōḥ punaḥ kriyāṁ nirdiśannāha- tayōśca pittakriyāṁ kurvītētyādi| vamanajīvādānē tu atisrutaśōṇitavidhānātidēśēna ēṇādiśōṇitapānamupadiṣṭaṁ tathēdānīṁ raktātisārakriyāvidhānaṁ cēti| ayaṁ pāṭhō'bhāvānna likhitaḥ||12-14||

Meaning of the commentary

The commentary calls this severe complication jīvādāna and presents it as difficult to treat. It explains tongue displacement as either outward protrusion or inward retraction, eye change as upward turning, jaw closure as loss of movement, and tremor as shaking. It distinguishes the manifestations after excessive vamana from those after excessive virecana: bleeding is common to both, but rectal prolapse replaces tongue protrusion in the latter; Gayi also says eye turning, jaw locking, hiccup, and belching do not occur there. Jejjata instead reads the text as extending the other advanced-vamana complications, apart from tongue protrusion, to excessive virecana. Their disagreement must remain unresolved. The commentary explains the traditional blood descriptions and assigns historical measures to particular signs. It reports a cloth test and a feeding test involving a dog as attempted distinctions between jīvaśoṇita and raktapitta, then notes that a further passage about treatment is absent from its received text.

Key terms

jīvādāna
The name given to the gravest bleeding complication of excessive elimination.
jīvaśoṇita
Blood regarded by the text as vital or pure bodily blood.
gudaniḥsaraṇa
Prolapse or outward displacement of the rectal region described after excessive purgation.
visaṃjñā
Loss or marked impairment of consciousness.

Adhikarana 11 (15) · Śloka 15

saśēṣānnēna bahudōṣēṇa rūkṣēṇānilaprāyakōṣṭhēnānuṣṇamasnigdhaṁ vā pītamauṣadhamādhmāpayati, tatrānilamūtrapurīṣasaṅgaḥ samunnaddhōdaratā pārśvabhaṅgō gudabastinistōdanaṁ bhaktāruciśca bhavati, taṁ cādhmānamityācakṣatē; tamupasvēdyānāhavartidīpanabastikriyābhirupacarēt ||15||

View original

सशेषान्नेन बहुदोषेण रूक्षेणानिलप्रायकोष्ठेनानुष्णमस्निग्धं वा पीतमौषधमाध्मापयति, तत्रानिलमूत्रपुरीषसङ्गः समुन्नद्धोदरता पार्श्वभङ्गो गुदबस्तिनिस्तोदनं भक्तारुचिश्च भवति, तं चाध्मानमित्याचक्षते; तमुपस्वेद्यानाहवर्तिदीपनबस्तिक्रियाभिरुपचरेत् ||१५||

Meaning of the śloka

When medicine that is insufficiently warm or unctuous is taken while food remains undigested, by a person described as having abundant doṣa, dryness, and a vāta-predominant koṣṭha, it may produce ādhmāna. The stated features are retention of flatus, urine, and stool; a tense, distended abdomen; pain or breaking discomfort in the flanks; pricking pain in the rectal and bladder regions; and loss of appetite. The passage then names historical warming, suppository, dīpana, and basti measures.

🔊 Audio coming soon

Hide commentary

jīvādānavyāpadamabhidhāya dvayōrapi śuddhyōrādhmānākhyāṁ vyāpadamupadiśannāha- saśēṣānnēnētyādi| samunnaddhōdaratēti vamanakr̥taṁ samunnaddhōdaratvamāmāśayē, virēcanakr̥taṁ pakvāśayē| tatra svēdanamūtrādyanulōmanalaṅghanadīpanakriyāścēti cikitsitam||15||

Meaning of the commentary

After jīvādāna, the commentary introduces ādhmāna as a complication shared by both forms of śuddhi. It locates the distension caused by vamana in the āmāśaya and that caused by virecana in the pakvāśaya. Its brief treatment gloss adds fomentation, measures intended to restore the movement of urine and related functions, fasting or lightening, and dīpana within the historical framework.

Key terms

ādhmāna
Tense abdominal distension with obstructed bodily discharges in this complication.
anila-mūtra-purīṣa-saṅga
Retention or obstruction of flatus, urine, and stool.
āmāśaya
The upper digestive region where the commentary locates distension associated with vamana.
pakvāśaya
The lower intestinal region where the commentary locates distension associated with virecana.

Adhikarana 12 (16) · Śloka 16

kṣāmēṇātimr̥dukōṣṭhēna mandāgninā rūkṣēṇa vā'titīkṣṇōṣṇātilavaṇamatirūkṣaṁ vā pītamauṣadhaṁ pittānilau pradūṣya parikartikāmāpādayati, tatra gudanābhimēḍhrabastiśiraḥsu sadāhaṁ parikartanamanilasaṅgō vāyuviṣṭambhō bhaktāruciśca bhavati; tatra picchābastiryaṣṭīmadhukakr̥ṣṇatilakalkamadhughr̥tayuktaḥ, śītāmbupariṣiktaṁ cainaṁ payasā bhuktavantaṁ ghr̥tamaṇḍēna yaṣṭīmadhukasiddhēna tailēna vā'nuvāsayēt ||16||

View original

क्षामेणातिमृदुकोष्ठेन मन्दाग्निना रूक्षेण वाऽतितीक्ष्णोष्णातिलवणमतिरूक्षं वा पीतमौषधं पित्तानिलौ प्रदूष्य परिकर्तिकामापादयति, तत्र गुदनाभिमेढ्रबस्तिशिरःसु सदाहं परिकर्तनमनिलसङ्गो वायुविष्टम्भो भक्तारुचिश्च भवति; तत्र पिच्छाबस्तिर्यष्टीमधुककृष्णतिलकल्कमधुघृतयुक्तः, शीताम्बुपरिषिक्तं चैनं पयसा भुक्तवन्तं घृतमण्डेन यष्टीमधुकसिद्धेन तैलेन वाऽनुवासयेत् ||१६||

Meaning of the śloka

In an emaciated or weakened person, one with very soft koṣṭha, weak agni, or dryness, a medicine that is excessively sharp, hot, salty, or drying may disturb pitta and vāta and cause parikartikā. The passage describes burning, cutting pain around the rectum, navel, genital region, bladder, and head, together with retention of vāta, obstructed flatus, and loss of appetite. It then records historical picchā-basti and unctuous measures.

🔊 Audio coming soon

Hide commentary

parikartikāvyāpadaṁ darśayannāha- kṣāmēṇētyādi| kṣāmaḥ kṣīṇabalakāyaḥ| pari sarvatō bhāvēna kr̥ntatīva chinattīva bastyādīnīti parikartikā| tatra pittōlbaṇaparikartikāyāṁ ghr̥tamaṇḍēnānuvāsanaṁ, vātōlbaṇāyāṁ tu tailēnēti| vamanē punaḥ kaṇṭhōrasi sadāhaparikartanaṁ; tatra ghr̥tamadhumadhuraiḥ saśītairlēpairupacāraḥ payaḥsitābhōjanaṁ ca||16||

Meaning of the commentary

The commentary defines kṣāma as a person whose body and strength are depleted. It explains parikartikā as a sensation of cutting all around the bladder and related regions. Within the traditional differentiation, ghee-derived treatment is assigned to a pitta-predominant form and oil to a vāta-predominant form. For the corresponding complication after vamana, it places burning and cutting pain in the throat and chest and records cooling applications and milk-and-sugar food as the historical response.

Key terms

parikartikā
A complication characterized by severe cutting pain and burning in the regions named by the source.
kṣāma
Emaciated or depleted in bodily strength, as glossed by the commentary.
atimṛdu koṣṭha
An extremely responsive or soft bowel constitution in the classical classification.
picchā-basti
A retaining or mucilaginous enema named as a historical measure.

Adhikarana 13 (17) · Śloka 17

krūrakōṣṭhasyātiprabhūtadōṣasya mr̥dvauṣadhamavacāritaṁ samutkliśya dōṣānna niḥśēṣānapaharati, tatastē dōṣāḥ parisrāvamāpādayanti, tatra daurbalyōdaraviṣṭambhārucigātrasadanāni bhavanti, savēdanau cāsya pittaślēṣmāṇau parisravataḥ, taṁ parisrāvamityācakṣatē; tamajakarṇadhavatiniśapalāśabalākaṣāyairmadhusaṁyuktairāsthāpayēt, upaśāntadōṣaṁ snigdhaṁ ca bhūyaḥ saṁśōdhayēt ||17||

View original

क्रूरकोष्ठस्यातिप्रभूतदोषस्य मृद्वौषधमवचारितं समुत्क्लिश्य दोषान्न निःशेषानपहरति, ततस्ते दोषाः परिस्रावमापादयन्ति, तत्र दौर्बल्योदरविष्टम्भारुचिगात्रसदनानि भवन्ति, सवेदनौ चास्य पित्तश्लेष्माणौ परिस्रवतः, तं परिस्रावमित्याचक्षते; तमजकर्णधवतिनिशपलाशबलाकषायैर्मधुसंयुक्तैरास्थापयेत्, उपशान्तदोषं स्निग्धं च भूयः संशोधयेत् ||१७||

Meaning of the śloka

In a person with krūra koṣṭha and very abundant doṣa, a mild medicine may agitate the doṣas without removing them completely, after which they cause parisrāva. The stated features are weakness, abdominal obstruction or distension, loss of appetite, bodily exhaustion, and painful discharge of pitta and śleṣman. The passage then records a historical herbal basti and renewed oleation and elimination after the complication has subsided.

🔊 Audio coming soon

Hide commentary

parisrāvākhyāṁ vyāpadaṁ darśayannāha- krūrētyādi| ajakarṇō'śvakarṇaḥ prasiddha ēva pūrvadēśē, dhava indravr̥kṣaḥ, tiniśaḥ syandanaḥ| upaśāntadōṣamiti upaśāntaparisrāvam| bhūyaḥ punarapi snigdhaṁ tīkṣṇaiḥ saṁśōdhanaiḥ saṁśōdhayēt| vamanē punarūrdhvaṁ kaphaprasēkaḥ; tatrādhyāhārēṇōpaśāntadōṣaṁ susnigdhasvinnaṁ mr̥dunā'lpēna vamanēna yathāyōgaṁ vāmayēt| gayī tu upaśāntadōṣamiti rūkṣasnigdhakōṣṭhaṁ saṁśamanapācanābhyāṁ śamitōtkliṣṭadōṣamāsthāpayēcchōdhayēdvēti vyākhyāti||17||

Meaning of the commentary

The commentary identifies this complication as parisrāva and gives botanical equivalents for three ingredients: ajakarṇa as aśvakarṇa, dhava as indravṛkṣa, and tiniśa as syandana. It interprets upaśāntadoṣa here as the subsiding of parisrāva and then describes renewed oleation followed by sharp elimination. For the vamana form it describes upward kapha discharge and, after settling it with additional food, a further mild, small vamana after oleation and fomentation. Gayi offers another interpretation: the phrase refers to a person whose agitated doṣas have been calmed through śamana and pācana, after which either basti or śodhana may be used. These readings should remain separate.

Key terms

parisrāva
A painful continuing discharge described as a complication of incomplete elimination.
krūra koṣṭha
A bowel constitution considered difficult to purge in the classical framework.
śamana
Pacification, used in Gayi's alternative explanation.
pācana
A processing or digestive measure paired with śamana in Gayi's reading.

Adhikarana 14 (18) · Śloka 18

atirūkṣē'tisnigdhē vā bhēṣajamavacāritamaprāptaṁ vātavarca udīrayati vēgāghātēna vā, tadā pravāhikā bhavati; tatra savātaṁ sadāhaṁ saśūlaṁ guru picchilaṁ śvētaṁ kr̥ṣṇaṁ saraktaṁ vā bhr̥śaṁ pravāhamāṇaḥ kaphamupaviśati; tāṁ parisrāvavidhānēnōpacarēt ||18||

View original

अतिरूक्षेऽतिस्निग्धे वा भेषजमवचारितमप्राप्तं वातवर्च उदीरयति वेगाघातेन वा, तदा प्रवाहिका भवति; तत्र सवातं सदाहं सशूलं गुरु पिच्छिलं श्वेतं कृष्णं सरक्तं वा भृशं प्रवाहमाणः कफमुपविशति; तां परिस्रावविधानेनोपचरेत् ||१८||

Meaning of the śloka

When medicine is administered to a person who is excessively dry or excessively unctuous, it may prematurely set vāta and stool in motion, or their urge may be obstructed. The text says that pravāhikā then develops: the person strains repeatedly and passes kapha that may be accompanied by vāta, burning and pain, and may be heavy, slimy, white, black, or blood-stained. It directs that this be managed according to the method stated for parisrāva.

🔊 Audio coming soon

Hide commentary

pravāhikākhyāṁ trayōdaśīṁ vyāpadaṁ darśayannāha- atirūkṣa ityādi| atirūkṣē puruṣē bhēṣajamavacāritamaprāptavēgamēva vātavarca udīrayati pravartayati yadā tadā pravāhikā; atisnigdhē puruṣē bhēṣajamavacāritaṁ yadā tadā vēgāghātēna pravāhikā bhavatītyarthaḥ| upaviśati atisārayati| tāṁ parisrāvavidhānēnētyādi| tatrātirūkṣajāṁ krūrakōṣṭhavidhānēna, atisnigdhajāṁ mr̥dukōṣṭhapracuradōṣaparisrāvōktapācanādividhānēna||18||

Meaning of the commentary

The commentary identifies this as the thirteenth complication, called pravāhikā. In an excessively dry person, the medicine produces an urge before the intended therapeutic action has properly arisen; in an excessively unctuous person, pravāhikā is attributed to obstruction of the urge. It explains upaviśati here as repeated diarrhoeal evacuation. It then distinguishes the historical management by cause: the form arising from excessive dryness is related to the method for krūra koṣṭha, whereas the form arising from excessive unctuousness is related to the digestive and associated measures described for parisrāva in a person with mṛdu koṣṭha and abundant doṣa.

Key terms

pravAhikA (pravāhikā)
A complication characterized here by repeated straining and passage of mucus, sometimes with pain, burning, or blood.
atirUkSha (atirūkṣa)
An excessively dry state of the person in the passage's causal account.
atisnigdha
An excessively unctuous state of the person in the passage's causal account.
vegAghAta (vegāghāta)
Obstruction or suppression of an arising bodily urge.
parisrAva (parisrāva)
A previously described complication whose management framework is referenced here.

Adhikarana 15 (19) · Śloka 19

yastūrdhvamadhō vā bhēṣajavēgaṁ pravr̥ttamajñatvādvinihanti tasyōpasaraṇaṁ hr̥di kurvanti dōṣāḥ, tatra pradhānamarmasantāpādvēdanābhiratyarthaṁ pīḍyamānō dantān kiṭakiṭāyatē udgatākṣō jihvāṁ khādati pratāmyatyacētāśca bhavati, taṁ parivarjayanti mūrkhāḥ; tamabhyajya dhānyasvēdēna svēdayēt, yaṣṭimadhukasiddhēna ca tailēnānuvāsayēt, śirōvirēcanaṁ cāsmai tīkṣṇaṁ vidadhyāt, tatō yaṣṭimadhukamiśrēṇa taṇḍulāmbunā chardayēt, yathādōṣōcchrāyēṇa cainaṁ bastibhirupācarēt ||19||

View original

यस्तूर्ध्वमधो वा भेषजवेगं प्रवृत्तमज्ञत्वाद्विनिहन्ति तस्योपसरणं हृदि कुर्वन्ति दोषाः, तत्र प्रधानमर्मसन्तापाद्वेदनाभिरत्यर्थं पीड्यमानो दन्तान् किटकिटायते उद्गताक्षो जिह्वां खादति प्रताम्यत्यचेताश्च भवति, तं परिवर्जयन्ति मूर्खाः; तमभ्यज्य धान्यस्वेदेन स्वेदयेत्, यष्टिमधुकसिद्धेन च तैलेनानुवासयेत्, शिरोविरेचनं चास्मै तीक्ष्णं विदध्यात्, ततो यष्टिमधुकमिश्रेण तण्डुलाम्बुना छर्दयेत्, यथादोषोच्छ्रायेण चैनं बस्तिभिरुपाचरेत् ||१९||

Meaning of the śloka

If a person ignorantly suppresses an already active upward or downward medicinal urge, the doṣas are said to move toward the heart. Affliction of this principal marma produces extreme distress: tooth-clenching, protruding or upturned eyes, biting of the tongue, faintness, and loss of consciousness. The text criticizes those who abandon such a person and then lists historical measures involving anointing and fomentation, medicated oil, sharp cleansing of the head, induced vomiting, and basti selected according to the predominance of doṣa.

🔊 Audio coming soon

Hide commentary

hr̥dayōpasaraṇākhyāṁ caturdaśīṁ vyāpadaṁ darśayannāha- ya ityādi| pradhānamarmasantāpāt hr̥dayasantāpāt| pratāmyati muhyati| acētā naṣṭasañjñaḥ| taṁ parivarjayanti mūrkhāḥ kuvaidyāḥ mumūrṣatīti hētōḥ| yaṣṭimadhukamiśrēṇa taṇḍulāmbunā pittamūrcchārtaṁ rchdayēt; kaphamūrcchāyāṁ tu kaṭukadravyāṇāṁ kvāthēna vāmayēt| bastibhiriti nairūhikaiḥ snēhikaiśca||19||

Meaning of the commentary

The commentary calls this the fourteenth complication, hṛdayopasaraṇa. It explains the affliction of the principal marma as distress of the heart, pratāmyati as becoming faint or confused, and acetā as loss of consciousness. Those who leave the patient because they assume death is imminent are described as foolish or incompetent practitioners. In interpreting the historical regimen, it distinguishes fainting attributed to pitta from that attributed to kapha and explains that both evacuative and unctuous forms of basti are included. These distinctions are the commentator's account and do not establish a safe modern treatment.

Key terms

hRudayopasaraNa (hṛdayopasaraṇa)
The named complication in which doṣas are described as approaching or afflicting the heart.
pradhAnamarma (pradhānamarma)
A principal vital site, identified by the commentary here with the heart.
pratAmyati (pratāmyati)
Becomes faint or confused, according to the commentary.
acetA (acetā)
Without consciousness or awareness.
basti
A class of rectally administered therapies mentioned in the historical regimen.

Adhikarana 16 (20) · Śloka 20

yastūrdhvamadhō vā pravr̥ttadōṣaḥ śītāgāramudakamanilamanyadvā sēvēta, tasya dōṣāḥ srōtaḥsvavalīyamānā ghanībhāvamāpannā vātamūtraśakr̥dgrahamāpādya vibadhyantē , tasyāṭōpō dāhō jvarō vēdanāśca tīvrā bhavanti; tamāśu vāmayitvā prāptakālāṁ kriyāṁ kurvīta; adhōbhāgē tvadhōbhāgadōṣaharadravyaṁ saindhavāmlamūtrasaṁsr̥ṣṭaṁ virēcanāya pāyayēt, āsthāpanamanuvāsanaṁ ca yathādōṣaṁ vidadhyāt, yathādōṣamāhārakramaṁ ca; ubhayatōbhāgē tūpadravaviśēṣān yathāsvaṁ pratikurvīta ||20||

View original

यस्तूर्ध्वमधो वा प्रवृत्तदोषः शीतागारमुदकमनिलमन्यद्वा सेवेत, तस्य दोषाः स्रोतःस्ववलीयमाना घनीभावमापन्ना वातमूत्रशकृद्ग्रहमापाद्य विबध्यन्ते , तस्याटोपो दाहो ज्वरो वेदनाश्च तीव्रा भवन्ति; तमाशु वामयित्वा प्राप्तकालां क्रियां कुर्वीत; अधोभागे त्वधोभागदोषहरद्रव्यं सैन्धवाम्लमूत्रसंसृष्टं विरेचनाय पाययेत्, आस्थापनमनुवासनं च यथादोषं विदध्यात्, यथादोषमाहारक्रमं च; उभयतोभागे तूपद्रवविशेषान् यथास्वं प्रतिकुर्वीत ||२०||

Meaning of the śloka

If, while doṣas are moving upward or downward, a person is exposed to a cold room, cold water, wind, or something similar, the doṣas are said to contract within the channels and become dense. Their movement is obstructed, producing retention of flatus, urine, and stool, with distension, burning, fever, and severe pain. The text then gives historical measures according to whether the obstruction concerns the upper route, lower route, or both, and directs that diet and complications be addressed according to the doṣa.

🔊 Audio coming soon

Hide commentary

vibandhākhyāṁ pañcadaśīṁ vyāpadaṁ darśayannāha- ya ityādi| vibadhyantē vamanavirēcanayōḥ pravr̥ttiṁ nivārayantītyarthaḥ| prāptakālāṁ prāptāvasthāṁ kriyāṁ kurvīta| adhōbhāgē ityādi| virēcanē tu vibandhē adhōbhāgaharadravyaṁ trivr̥dādi saindhavādisaṁsr̥ṣṭaṁ virēkārthaṁ pāyayēt| yathādōṣamēva yūṣakṣīrarasādyāhārakramaśca| kiṁ bahunā ubhayatōbhāgē tu upadravaviśēṣān yathāsvaṁ pratikurvīta| gayī tu apravr̥ttadōṣō'pracyutadōṣa iti kr̥tvā vyākhyāti||20||

Meaning of the commentary

The commentary names this fifteenth complication vibandha and explains that the obstruction prevents the progress of vamana or virecana. The phrase prāptakālā kriyā is understood as treatment appropriate to the stage reached. For obstruction during virecana, it describes a historical purgative combination and a doṣa-based dietary sequence. If both routes are affected, each particular complication is to be addressed in its own way. The commentary also preserves Gayi's different interpretation: he reads the condition as involving doṣas that have not begun to move or have not been dislodged, rather than doṣas already in motion.

Key terms

vibandha
Obstruction of the intended upward or downward therapeutic movement.
vAtamUtrashakRudgraha (vātamūtraśakṛdgraha)
Retention of flatus, urine, and stool described as part of the complication.
srotas
Channels within which the doṣas are said to contract and become obstructed.
prAptakAlA kriyA (prāptakālā kriyā)
An intervention considered appropriate to the stage reached, as explained by the commentary.
ubhayatobhAga (ubhayatobhāga)
Involvement of both the upward and downward routes.

Adhikarana 17 (21) · Śloka 21

yā tu virēcanē gudaparikartikā tadvamanē kaṇṭhakṣaṇanaṁ, yadadhaḥ parisravaṇaṁ sa ūrdhvabhāgē ślēṣmaprasēkaḥ, yā tvadhaḥ pravāhikā sā tūrdhvaṁ śuṣkōdgārā iti ||21||

View original

या तु विरेचने गुदपरिकर्तिका तद्वमने कण्ठक्षणनं, यदधः परिस्रवणं स ऊर्ध्वभागे श्लेष्मप्रसेकः, या त्वधः प्रवाहिका सा तूर्ध्वं शुष्कोद्गारा इति ||२१||

Meaning of the śloka

The text pairs certain complications of the downward and upward therapies. The anal cutting pain associated with virecana corresponds in vamana to injury or excoriation of the throat; downward parisrāva corresponds in the upper route to excessive salivary or mucous flow; and downward pravāhikā corresponds upward to dry eructations.

🔊 Audio coming soon

Hide commentary

tāsvapi kāsucidēvāntaramiti tadupadarśayannāha- yā tvityādi||21||

Meaning of the commentary

The commentary says that the purpose of the passage is to show the differences that occur in only some of the otherwise corresponding complications. It adds no further explanation of the individual terms.

Key terms

gudaparikartikA (gudaparikartikā)
Cutting pain or injury in the anal region associated here with virecana.
kaNThakShaNana (kaṇṭhakṣaṇana)
Injury, abrasion, or cutting pain of the throat associated here with vamana.
shleShmapraseka (śleṣmapraseka)
Excess flow of saliva or mucus in the upper-route comparison.
pravAhikA (pravāhikā)
A lower-route complication marked in the preceding passage by repeated straining and mucous discharge.
shuShkodgAra (śuṣkodgāra)
Dry eructation, presented as the upper-route counterpart of pravāhikā.

Adhikarana 18 (22) · Śloka 22

bhavati cātra- yāstvētā vyāpadaḥ prōktā daśa pañca ca tattvataḥ | ētā virēkātiyōgaduryōgāyōgajāḥ smr̥tāḥ ||22||

View original

भवति चात्र- यास्त्वेता व्यापदः प्रोक्ता दश पञ्च च तत्त्वतः | एता विरेकातियोगदुर्योगायोगजाः स्मृताः ||२२||

Meaning of the śloka

The fifteen complications described in detail are understood to arise from excessive application, improper application, or inadequate application of vireka, a term used here for eliminative therapy.

🔊 Audio coming soon

Hide commentary

idānīṁ ślōkasaṅgrahamāha- bhavati cātrētyādi| tattvataḥ paramārthataḥ| virēkō'tra dōṣamalarēcanādvirēcanaṁ vamanaṁ ca| jējjaṭācāryastu vipākātiyōgētyādi paṭhitvā vyākhyānayativiṣamaḥ pākō'niṣṭaṁ phalaṁ yēṣāṁ tē vipākāḥ, vipākāśca tē'tiyōgaduryōgāyōgāśca tēbhyō jāyantē tē tathā| tatrātiyōjanamatiyōga atiprayōga iti yāvat; tajjātē dvē vyāpadau- jīvādānamatiyōgaścēti| duryōjanaṁ duryōgaḥ duṣprayōgō mithyāprayōga iti yāvat; tatra vaidyaduryōganimittāścatasraḥ- vamanamithyāprayōgō, virēcanamithyāprayōga, ādhmānaṁ, parikartikā cēti; āturaduryōganimittē dvē- hr̥dayōpasaraṇavibandhāviti; ubhayaduryōgajē api dvē- pravāhikā, vātaśūlaṁ cēti| ayōjanam ayōgaḥ hīnaprayōgaḥ , naña īṣadarthatvāt| tatrāyōgajāḥ pañca- sāvaśēṣauṣadhatvaṁ, jīrṇauṣadhatā, hīnadōṣahr̥tatvam ayōgaḥ, parisrāvaścēti| tā ētā vaidyāturanimittā, āturanimittā, vaidyanimittāścēti trividhāḥ| anyē tu tantrāntaradarśanādayōgātiyōgajāḥ sarvā api vyāpadō yathāsaṅkhyaṁ manyantē; tatrāyōgajā daśa, tadyathā- sāvaśēṣauṣadhatvaṁ, jīrṇauṣadhatvam, alpadōṣahr̥tatvaṁ, vibandhō, vātaśūlam, ādhmānaṁ, parisrāvaḥ, pravāhikā, hr̥dayōpasaraṇam, ayōgaścēti; atiyōgajāśca tisraḥ- jīvādānaṁ, parikartikā, atiyōgaścēti; ayōgātiyōgau ca hētutvēnōktāvityēvaṁ pañcadaśa||22||

Meaning of the commentary

The commentary presents this verse as a summary and explains that vireka here includes both virecana and vamana because both evacuate doṣa and waste. It then preserves Jejjaṭa's alternative reading with vipāka and his classification: two complications from excessive application; several from improper application, subdivided according to practitioner, patient, or both; and five from inadequate application. A further view, based on other treatises, classifies ten complications under inadequate application and three under excessive application, while counting ayoga and atiyoga themselves as causes, yielding fifteen in all. These schemes are alternative enumerations and should not be collapsed into a single list.

Key terms

vyApad (vyāpad)
A complication or adverse outcome of the therapies discussed.
atiyoga
Excessive application or overuse.
duryoga
Improper, faulty, or wrongly applied use.
ayoga
Inadequate or deficient application; the commentary notes a slight or insufficient use.
vireka
Eliminative therapy, interpreted by the commentary here as encompassing both vamana and virecana.
vipAka (vipāka)
In Jejjaṭa's alternative reading, therapies or applications whose outcome is adverse or irregular.

Adhikarana puṣpikā · Śloka 34

iti suśrutasaṁhitāyāṁ cikitsāsthānē vamanavirēcanavyāpaccikitsitaṁ nāma catustriṁśō'dhyāyaḥ ||34||

View original

इति सुश्रुतसंहितायां चिकित्सास्थाने वमनविरेचनव्यापच्चिकित्सितं नाम चतुस्त्रिंशोऽध्यायः ||३४||

Meaning of the śloka

Thus ends the thirty-fourth chapter of the Cikitsāsthāna in the Suśruta Saṃhitā, entitled Vamanavirecanavyāpaccikitsita, the treatment of complications arising from emesis and purgation.

🔊 Audio coming soon

Hide commentary

iti śrīḍalha(hla)ṇaviracitāyāṁ nibandhasaṅgrahākhyāyāṁ suśrutavyākhyāyāṁ cikitsāsthānē catustriṁśattamō'dhyāyaḥ||34||

Meaning of the commentary

The colophon states that the thirty-fourth chapter of the Cikitsāsthāna is complete in Dalhaṇa's commentary on the Suśruta Saṃhitā entitled Nibandhasaṅgraha. The supplied text contains the variant spelling Dalhaṇa/Dalhlaṇa, which should be checked against the edition.

Key terms

cikitsAsthAna (cikitsāsthāna)
The section of the work concerned with treatment.
vamanavirecanavyApaccikitsita (vamanavirecanavyāpaccikitsita)
The chapter title concerning treatment of complications of emesis and purgation.
Nibandhasa~ggraha (Nibandhasaṅgraha)
The title of Dalhaṇa's commentary.
DalhaNa (Dalhaṇa)
The commentator named in the closing statement.